PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000126517
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family NAC
Protein Properties Length: 255aa    MW: 28901.9 Da    PI: 9.0628
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000126517genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM163.67.3e-51141381128
            NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk. 95 
                    lppGfrFhPtdeelv +yL++k+ + +l++ ++i+evd++k++PwdLp      e+e yfFs+r+ ky++g+r+nrat sgyWkatg dk++++  
  MDP0000126517  14 LPPGFRFHPTDEELVLQYLRRKAYSCPLPA-SIIPEVDVCKADPWDLPGD---CEQERYFFSTREAKYPNGNRSNRATCSGYWKATGLDKQIVTCr 105
                    79****************************.89***************44...46799*********************************98765 PP

            NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                    +g++vg+kktLvfy+g+ p+g++tdW+mheyrl
  MDP0000126517 106 GGQVVGMKKTLVFYRGKPPHGTRTDWIMHEYRL 138
                    8999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.89E-6110173IPR003441NAC domain
PROSITE profilePS5100557.3714173IPR003441NAC domain
PfamPF023651.9E-2615138IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0010089Biological Processxylem development
GO:0010150Biological Processleaf senescence
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 255 aa     Download sequence    Send to blast
MERISFVKNG VLRLPPGFRF HPTDEELVLQ YLRRKAYSCP LPASIIPEVD VCKADPWDLP  60
GDCEQERYFF STREAKYPNG NRSNRATCSG YWKATGLDKQ IVTCRGGQVV GMKKTLVFYR  120
GKPPHGTRTD WIMHEYRLVL PENPASIAPP EKNSTQSPVV PMDNWVLCRI FLKKRGGKNE  180
EEQVQQPSFN VRKPKNLRPV FYDFMTKDRE NLSLAPCSSS SGSSGITDVV SSEQVDNDHG  240
ESSSCNSLGL IRRKQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-531217415166NO APICAL MERISTEM PROTEIN
1ut4_B3e-531217415166NO APICAL MERISTEM PROTEIN
1ut7_A3e-531217415166NO APICAL MERISTEM PROTEIN
1ut7_B3e-531217415166NO APICAL MERISTEM PROTEIN
4dul_A3e-531217415166NAC domain-containing protein 19
4dul_B3e-531217415166NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.39630.0bud| fruit| leaf| root
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00507DAPTransfer from AT5G13180Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008389924.10.0PREDICTED: NAC transcription factor 25-like
SwissprotQ9FY932e-98NAC83_ARATH; NAC domain-containing protein 83
TrEMBLD9ZJA01e-174D9ZJA0_MALDO; NAC domain class transcription factor
STRINGPOPTR_0001s13380.11e-129(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF70434139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13180.15e-99NAC domain containing protein 83